Invitrogen™ Human Dynactin 1 (aa 532-611) Control Fragment Recombinant Protein

Product Code. 30200802

Brand: Invitrogen™ RP96242

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83239 (PA5-83239. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA).

Specifications

• Accession Number: Q14203
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1639
• Name: Human Dynactin 1 (aa 532-611) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 150 kDa dynein-associated polypeptide; AL022633; DAP 150; DAP150; DAP-150; DCTN 1; DCTN1; DP 150; DP150; DP-150; dynactin 1; dynactin 1 (p150, glued homolog, Drosophila); dynactin 1, retrograde axonal transport; dynactin subunit 1; Dynactin1; Glued; HMN7B; OTTHUMP00000202491; p135; p150; p150 glued; p150 glued homolog; p150glued; p150-glued
• Common Name: Dynactin 1
• Gene Symbol: DCTN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining