Invitrogen™ Human DYDC2 (aa 102-176) Control Fragment Recombinant Protein

Product Code. 30204727

Brand: Invitrogen™ RP97083

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58207 (PA5-58207. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DYDC2 encodes a member of a family of proteins that contains a DPY30 domain. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q96IM9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84332
• Name: Human DYDC2 (aa 102-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA36D19.6; DPY30 domain containing 2; DPY30 domain-containing protein 2; DYDC2; MGC16186; SPS1; SRML1
• Common Name: DYDC2
• Gene Symbol: DYDC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining