Invitrogen™ Human DVL3 (aa 116-170) Control Fragment Recombinant Protein

Product Code. 30195695

Brand: Invitrogen™ RP103321

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84372 (PA5-84372. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of a multi-gene family which shares strong similarity with the Drosophila disheveled gene, dsh. The Drosophila disheveled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.

Specifications

• Accession Number: Q92997
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1857
• Name: Human DVL3 (aa 116-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: dishevelled 3 (homologous to Drosophila dsh); dishevelled 3, dsh homolog; dishevelled 3, dsh homolog (Drosophila); dishevelled segment polarity protein 3; dishevelled, dsh homolog 3; dishevelled-3; DRS3; DSH homolog 3; DVL3; dvl-3; I79_017820; KIAA0208; OTTHUMP00000210778; Segment polarity protein dishevelled homolog DVL-3; Segment polarity protein dishevelled-like DVL-3
• Common Name: DVL3
• Gene Symbol: DVL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining