Invitrogen™ Human DUSP7 (aa 51-90) Control Fragment Recombinant Protein

Product Code. 30197962

Brand: Invitrogen™ RP109313

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DUSP7 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP)kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associatedwith cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.

Specifications

• Accession Number: Q16829
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1849
• Name: Human DUSP7 (aa 51-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU015694; dual specificity phosphatase 6; dual specificity phosphatase 7; dual specificity protein phosphatase 7; Dual specificity protein phosphatase MKP-X; dual specificity protein phosphatase PYST2; dual-specificity phosphatase-7; DUSP7; fd19d04; hypothetical protein LOC327246; MAP kinase phosphatase; Mkpx; mkp-X; PYST2; wu:fd19d04; zgc:55957; zgc:77211; zgc:77211 protein
• Common Name: DUSP7
• Gene Symbol: DUSP7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining