Invitrogen™ Human DUSP3 (aa 134-185) Control Fragment Recombinant Protein

Product Code. 30210351

Brand: Invitrogen™ RP107263

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111569 (PA5-111569. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein tyrosine phosphatases (PTPs) are a group of enzymes that remove phosphate groups from phosphorylated tyrosine residues on proteins. Together with tyrosine kinases, PTPs regulate the phosphorylation state of many important signaling molecules, such as the MAP kinase family. Recently, increasing attention has been focused on the growing family of PTPs. Like PTKs, PTPs have been implicated in cell signaling, cell growth and proliferation, and oncogenic transformation. Moreover, some PTPs can be involved in cell cycle regulation and embryogenesis. Dual specificity phosphatases (DSPs) are an emerging subclass of the protein tyrosine phosphatase (PTP) gene superfamily, which appears to be selective for dephosphorylating the critical phosphothreonine and phosphotyrosine residues. The prototypical DSP is the VH1 gene in vaccinia virus expressed in late-stage viral infection. A shallow active site pocket in VHR allows for the hydrolysis of phosphorylated serine, threonine, or tyrosine protein residues, whereas the deeper active site of protein tyrosine phosphatases (PTPs) restricts substrate specificity to only phosphotyrosine.

Specifications

• Accession Number: P51452
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1845
• Name: Human DUSP3 (aa 134-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210015O03Rik; 5031436O03Rik; dual specificity phosphatase 3; dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related); dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)-like; dual specificity protein phosphatase 3; Dual specificity protein phosphatase VHR; DUSP 3; DUSP3; DUSP-3; RGD1560049; serine/threonine specific protein phosphatase; T-DSP11; Vaccinia H1-related phosphatase; vaccinia virus phosphatase VH1-related; VHR
• Common Name: DUSP3
• Gene Symbol: Dusp3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining