Invitrogen™ Human DUSP27 (aa 250-282) Control Fragment Recombinant Protein

Product Code. 30204883

Brand: Invitrogen™ RP90298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64945 (PA5-64945. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DUSP27 (Dual Specificity Phosphatase 27, Atypical) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP13.

Specifications

• Accession Number: Q5VZP5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92235
• Name: Human DUSP27 (aa 250-282) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: atypical dual-specific protein phosphatase; dual specificity phosphatase 27; dual specificity phosphatase 27 (putative); dual specificity phosphatase and pro isomerase domain containing 1; dual specificity phosphatase DUPD1; DUPD1; DUSP27; FMDSP; Inactive dual specificity phosphatase 27
• Common Name: DUSP27
• Gene Symbol: DUSP27
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EALMTVRKKRAIYPNEGFLKQLRELNEKLMEER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining