Invitrogen™ Human DUSP22 (aa 91-178) Control Fragment Recombinant Protein

Product Code. 30196952

Brand: Invitrogen™ RP91558

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83191 (PA5-83191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitogen-activated protein (MAP) kinases are a large class of proteins involved in signal transduction pathways that are activated by a range of stimuli and mediate a number of physiological and pathological changes in the cell. Dual specificity phosphatases (DSPs) are a subclass of the protein tyrosine phosphatase (PTP) gene superfamily, which are selective for dephosphorylating critical phosphothreonine and phosphotyrosine residues within MAP kinases. DSP gene expression is induced by a host of growth factors and/or cellular stresses, thereby negatively regulating MAP kinase superfamily members including MAPK/ERK, SAPK/JNK and p38. DUSP22 dephosphorylates ERK2 MAP kinase and JNK. DUSP22 displays highest in thymus, but it is also detectable in monocytes and lymphocytes.

Specifications

• Accession Number: Q9NRW4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56940
• Name: Human DUSP22 (aa 91-178) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DKFZp586F2224; dual specificity phosphatase 22; dual specificity protein phosphatase 22; Dusp22; homolog of mouse dual specificity phosphatase LMW-DSP2; JKAP; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; JSP 1; JSP1; JSP-1; LMWDSP2; LMW-DSP2; low molecular weight dual specificity phosphatase 2; MAP kinase phosphatase x; mi; mitogen-activated protein kinase phosphatase x; MKPX; MKP-x; PYST2; VHX
• Common Name: DUSP22
• Gene Symbol: Dusp22
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining