Invitrogen™ Human DUSP12 (aa 165-313) Control Fragment Recombinant Protein

Product Code. 30196645

Brand: Invitrogen™ RP89148

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110753 (PA5-110753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dual specificity phosphatase (DUSP) inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. DUSPs can be divided into six subgroups on the basis of sequence similarity (PRLs, Cdc14 phosphatases, PTENs, myotubularins, MKPs, atypical DUSPs). DUSP inhibitors might be used to manipulate MAPK and cellular responses in both positive and negative ways. The regulated expression and activity of DUSP family members in different cells and tissues controls MAPK intensity and duration to determine the type of physiological response. DUSP12 (YVH1, GKAP) contains the consensus DUSP catalytic domain as well as an extended C-terminal domain of unknown function, thought to be related to its potential role in glucokinase regulation. It is localized in the cytoplasm and nucleus.

Specifications

• Accession Number: Q9UNI6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11266
• Name: Human DUSP12 (aa 165-313) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190004O14Rik; AA027408; AW049275; dual specificity phosphatase 12; dual specificity phosphatase T-DSP4; Dual specificity phosphatase VH1; dual specificity protein phosphatase 12; Dual specificity tyrosine phosphatase YVH1; DUSP1; Dusp12; ESTM36; LMW-DSP4; mVH1; serine/threonine specific protein phosphatase; T-DSP4; VH1; YVH1; YVH1 protein-tyrosine phosphatase ortholog
• Common Name: DUSP12
• Gene Symbol: Dusp12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining