Invitrogen™ Human DUS4L (aa 135-218) Control Fragment Recombinant Protein

Product Code. 30210751

Brand: Invitrogen™ RP92638

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60671 (PA5-60671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Specifications

• Accession Number: O95620
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11062
• Name: Human DUS4L (aa 135-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310069P03Rik; 2700089B10Rik; AI482040; dihydrouridine synthase 4 like; dihydrouridine synthase 4-like; dihydrouridine synthase 4-like (S. cerevisiae); DUS4; DUS4L; pp35; protein similar to E.coli yhdg and R. capsulatus nifR3; tRNA-dihydrouridine synthase 4-like; tRNA-dihydrouridine(20 A/20 b) synthase [NAD(P)+]-like
• Common Name: DUS4L
• Gene Symbol: DUS4L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining