Invitrogen™ Human DUS2L (aa 101-210) Control Fragment Recombinant Protein

Product Code. 30182469

Brand: Invitrogen™ RP98737

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60405 (PA5-60405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dihydrouridine synthase catalyzes reduction of the 5,6-double bond of a uridine residue on the displacement loop of tRNA. The resultant modified base, 5,6-dihydrouridine, appears to increase the conformational flexibility and dynamic motion of tRNA (Kato et al., 2005 [PubMed 15994936]).

Specifications

• Accession Number: Q9NX74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54920
• Name: Human DUS2L (aa 101-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310016K04Rik; Dihydrouridine synthase 2; dihydrouridine synthase 2-like, SMM1 homolog; Dus2; Dus2l; hDUS2; RGD1305612; SMM1; SMM1 homolog; tRNA-dihydrouridine synthase 2-like; tRNA-dihydrouridine(20) synthase (NAD(P)(+)); tRNA-dihydrouridine(20) synthase [NAD(P)+]-like; Up-regulated in lung cancer protein 8; URLC8
• Common Name: DUS2L
• Gene Symbol: DUS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining