Invitrogen™ Human DTX4 (aa 182-230) Control Fragment Recombinant Protein

Código de producto. 30198831

Marca: Invitrogen™ RP101733

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63346 (PA5-63346. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DTX4 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. It functions as an ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.

Especificaciones

• Accession Number: Q9Y2E6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23220
• Name: Human DTX4 (aa 182-230) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI449438; BC044798; D930042H13; deltex 4 homolog; deltex 4 homolog (Drosophila); deltex 4, E3 ubiquitin ligase; deltex E3 ubiquitin ligase 4; deltex homolog 4; delte x 4; DT x 4; E3 ubiquitin-protein ligase DT x 4; KIAA0937; LRRGT00037; Protein deltex-4; RING finger protein 155; RING-type E3 ubiquitin transferase DT x 4; RNF155
• Common Name: DTX4
• Gene Symbol: DTX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining