Invitrogen™ Human DTX3 (aa 149-202) Control Fragment Recombinant Protein

Product Code. 30204749

Brand: Invitrogen™ RP101968

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63762 (PA5-63762. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Specifications

• Accession Number: Q8N9I9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 196403
• Name: Human DTX3 (aa 149-202) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: deltex 3 homolog (Drosophila); deltex 3, E3 ubiquitin ligase; deltex E3 ubiquitin ligase 3; deltex homolog 3; delte x 3; DT x 3; FLJ34766; mDT x 3; mg310; MGC138863; MGC138864; probable E3 ubiquitin-protein ligase DT x 3; Protein deltex-3; RING finger protein 154; RING-type E3 ubiquitin transferase DT x 3; RNF154
• Common Name: DTX3
• Gene Symbol: DTX3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining