Invitrogen™ Human DTX1 (aa 361-407) Control Fragment Recombinant Protein

Product Code. 30203144

Brand: Invitrogen™ RP105011

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84249 (PA5-84249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.

Specifications

• Accession Number: Q86Y01
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1840
• Name: Human DTX1 (aa 361-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: deltex 1; deltex 1 homolog (Drosophila); deltex 1, E3 ubiquitin ligase; deltex E3 ubiquitin ligase 1; deltex homolog 1; delte x 1; DT x 1; E3 ubiquitin-protein ligase DT x 1; fractionated x-irradiation induced transcript 1; Fxit1; FXI-T1; hDT x 1; hDx-1; mDT x 1; mKIAA4160; protein deltex-1; RING-type E3 ubiquitin transferase DT x 1
• Common Name: DTX1
• Gene Symbol: Dtx1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining