missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DTL (aa 455-541) Control Fragment Recombinant Protein

Product Code. 30195560
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195560

Brand: Invitrogen™ RP105876

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111036 (PA5-111036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1 and CDKN1A/p21(CIP1). CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZJ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51514
Name Human DTL (aa 455-541) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810047L02Rik; 5730564G15Rik; CDT2; CDW1; DCAF2; DDB1 and CUL4 associated factor 2; DDB1- and CUL4-associated factor 2; denticleless E3 ubiquitin protein ligase homolog; denticleless E3 ubiquitin protein ligase homolog (Drosophila); denticleless homolog; denticleless homolog (Drosophila); denticleless protein homolog; DTL; L2dtl; lethal(2) denticleless protein homolog; Meth A RAMP; Meth A retinoic acid-regulated nuclear matrix-associated protein; RA regulated nuclear matrix associated protein; RAMP; RA-regulated nuclear matrix-associated protein; Retinoic acid-regulated nuclear matrix-associated protein; RGD1310439
Common Name DTL
Gene Symbol DTL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.