Invitrogen™ Human DTL (aa 220-311) Control Fragment Recombinant Protein

Product Code. 30196231

Brand: Invitrogen™ RP94290

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55750 (PA5-55750. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1 and CDKN1A/p21(CIP1). CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis.

Specifications

• Accession Number: Q9NZJ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51514
• Name: Human DTL (aa 220-311) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810047L02Rik; 5730564G15Rik; CDT2; CDW1; DCAF2; DDB1 and CUL4 associated factor 2; DDB1- and CUL4-associated factor 2; denticleless E3 ubiquitin protein ligase homolog; denticleless E3 ubiquitin protein ligase homolog (Drosophila); denticleless homolog; denticleless homolog (Drosophila); denticleless protein homolog; DTL; L2dtl; lethal(2) denticleless protein homolog; Meth A RAMP; Meth A retinoic acid-regulated nuclear matrix-associated protein; RA regulated nuclear matrix associated protein; RAMP; RA-regulated nuclear matrix-associated protein; Retinoic acid-regulated nuclear matrix-associated protein; RGD1310439
• Common Name: DTL
• Gene Symbol: DTL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining