missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DTD1 (aa 12-81) Control Fragment Recombinant Protein

Product Code. 30182555
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182555

Brand: Invitrogen™ RP99405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59376 (PA5-59376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ferritin is a ubiquitous and highly conserved protein which plays a major role in iron homeostasis. It is a holoenzyme shell (approximately 450 kDa) consisting of 24 subunits of two types, H (heavy) and L (light), and capable of storing up to 4,500 atoms of ferric iron. Depending on the tissue type and physiologic status of the cell, the ratio of H to L subunits in ferritin can vary widely. It can be viewed not only as part of a group of iron regulatory proteins that include transferrin and the transferrin receptor, but also as a member of the protein family that orchestrates the cellular defense against stress and inflammation. Ferritin is found in the liver, spleen, kidney and heart. Only a small amount is found in the blood. The blood level of ferritin serves as an indicator of the amount of iron stored in the body.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TEA8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92675
Name Human DTD1 (aa 12-81) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610006H08Rik; bA379J5.3; bA555E18.1; C20orf88; D-aminoacyl-tRNA deacylase 1; DNA-unwinding element-binding protein B; DTD; DTD1; D-tyrosyl-tRNA deacylase 1; D-tyrosyl-tRNA deacylase 1 homolog; D-tyrosyl-tRNA(Tyr) deacylase 1; DUEB; DUE-B; Gly-tRNA(Ala) deacylase; HARS2; histidyl tRNA synthetase 2; histidyl-tRNA synthase-related; histidyl-tRNA synthetase 2; MGC119131; MGC41905; pqn-68
Common Name DTD1
Gene Symbol DTD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.