Invitrogen™ Human DSEL (aa 528-630) Control Fragment Recombinant Protein

Product Code. 30211637

Brand: Invitrogen™ RP105160

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66352 (PA5-66352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DSEL gene ontology annotations related to this gene include chondroitin sulfate metabolic process; dermatan sulfate biosynthetic process.

Specifications

• Accession Number: Q8IZU8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92126
• Name: Human DSEL (aa 528-630) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C18orf4; dermatan sulfate epimerase-like; dermatan-sulfate epimerase-like protein; DSEL; NCAG1
• Common Name: DSEL
• Gene Symbol: DSEL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WTGEEVGDAAGEIITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSAFFHNLDIDFKYIPYKFMNRYNGAMMDVWDA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining