Invitrogen™ Human DRD1 (aa 337-445) Control Fragment Recombinant Protein

Product Code. 30203501

Brand: Invitrogen™ RP108736

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene.

Specifications

• Accession Number: P21728
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1812
• Name: Human DRD1 (aa 337-445) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C030036C15Rik; D(1 A) dopamine receptor; D1 receptor; D1a; D1A dopamine receptor; D1a receptor; DADR; Dopamine 1 receptor; Dopamine D1 receptor; dopamine receptor D1; dopamine receptor D1A; Dopamine-1 A receptor; Drd1; Drd-1; Drd1a; G protein-coupled receptor DRD1; Gpcr15
• Common Name: DRD1
• Gene Symbol: DRD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining