Invitrogen™ Human DQX1 (aa 182-279) Control Fragment Recombinant Protein

Product Code. 30210043

Brand: Invitrogen™ RP96113

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58674 (PA5-58674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DQX1 (DEAQ box RNA-dependent ATPase 1), also known as FLJ23757, is a 71 amino acid protein that contains one helicase ATP-binding domain and one helicase C-terminal domain. Localized to the nucleus, DQX1 catalyzes the conversion of ATP to ADP and a phosphate. Expressed as three isoforms produced by alternative splicing events, DQX1 is encoded by a gene that maps to human chomosome 2. As the second largest human chromosome, chromosome 2 makes up approximately 8% of the human genome and contains 237 million bases encoding over 1,400 genes. A number of genetic diseases are linked to genes on chromosome 2, including Harlequin icthyosis, sitosterolemia and Alstrom syndrome.

Specifications

• Accession Number: Q8TE96
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 165545
• Name: Human DQX1 (aa 182-279) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310066E11Rik; ATP-dependent RNA helicase DQX1; DEAQ box polypeptide 1; DEAQ box polypeptide 1 (RNA-dependent ATPase); DEAQ box RNA-dependent ATPase 1; DEAQ RNA-dependent ATPase; DEAQ RNA-dependent ATPase DQX1; DEAQ-box RNA dependent ATPase 1; Dqx1
• Common Name: DQX1
• Gene Symbol: DQX1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining