Invitrogen™ Human DPYS Control Fragment Recombinant Protein

Code produit. 30209164

missing translation for 'mfr': Invitrogen™ RP110235

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

Spécification

• Accession Number: Q14117
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1807
• Name: Human DPYS Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200017I10Rik; 1300004I01Rik; DHP; DHPase; dihydropyrimidinase; Dihydropyrimidine amidohydrolase; Dpys; Hydantoinase
• Common Name: DPYS
• Gene Symbol: Dpys
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THYWKKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNNCQKAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining