Invitrogen™ Human DPPA2 (aa 102-183) Control Fragment Recombinant Protein

Product Code. 30211400

Brand: Invitrogen™ RP96402

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57536 (PA5-57536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.

Specifications

• Accession Number: Q7Z7J5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 151871
• Name: Human DPPA2 (aa 102-183) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410088E07Rik; C80932; cancer/testis antigen 100; CT100; D19Mgi18; developmental pluripotency associated 2; developmental pluripotency-associated 2; developmental pluripotency-associated protein 2; DPPA2; ECAT15-2; ECSA; embryonic stem cell (ESC) associated transcript 15-2; embryonic stem cell-associated transcript 15-2 protein; LOC683282; PESCRG1; Phsecrg1; Pluripotent embryonic stem cell-related gene 1 protein; similar to developmental pluripotency-associated 2
• Common Name: DPPA2
• Gene Symbol: DPPA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining