missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DPP6 (aa 582-662) Control Fragment Recombinant Protein

Product Code. 30207722
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207722

Brand: Invitrogen™ RP101264

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62201 (PA5-62201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DPP6 encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42658
Concentration 2.10 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1804
Name Human DPP6 (aa 582-662) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B930011P16Rik; D5Buc3; D5Buc4; D5Buc5; dipeptidyl aminopeptidase IV-related protein; dipeptidyl aminopeptidase-like protein 6; Dipeptidyl aminopeptidase-related protein; Dipeptidyl peptidase 6; Dipeptidyl peptidase IV-like protein; dipeptidyl peptidase IV-related protein; dipeptidyl peptidase like 6; dipeptidyl peptidase VI; dipeptidylpeptidase 6; dipeptidyl-peptidase 6; dipeptidylpeptidase VI; DPL1; DPP VI; Dpp6; Dpp-6; DPPX; Gm1377; In(5)6 H p; In(5)6 H-p; inversion, Chr 5, Harwell 6, proximal; MRD33; Peplb; Rw; VF2
Common Name DPP6
Gene Symbol DPP6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.