Invitrogen™ Human DPP4 (aa 325-416) Control Fragment Recombinant Protein

Product Code. 30208746

Brand: Invitrogen™ RP109253

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140252 (PA5-140252. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD26 (dipeptidyl peptidase IV, DPP IV), adenosine deaminase (ADA) binding protein) is a homodimeric atypical serine protease belonging to the prolyl oligopeptidase family. CD26 is expressed on lymphocyte cells and is upregulated during T-cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T-cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection. CD26 identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. Further, CD26 is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Alterations in CD26 peptidase activity are characteristic of malignant transformation, and the enzymatic activity increases dramatically with tumor grade and severity. CD26 is expressed in various blood cell types, but also in cells that are histogenetically related to activated fibroblasts. Alterations in CD26 density have been reported on circulating monocytes and CD4+ T cells during rheumatoid arthritis and systemic lupus erythematosus.

Specifications

• Accession Number: P27487
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1803
• Name: Human DPP4 (aa 325-416) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACT3; Activation molecule 3; ADABP; ADCP2; ADCP-2; ADCP-I; adenosine deaminase complexing protein; Adenosine deaminase complexing protein 2; bile canaliculus domain-specific membrane glycoprotein; CD26; Dipeptidyl peptidase 4; Dipeptidyl peptidase 4 60 kDa soluble form; Dipeptidyl peptidase 4 membrane form; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV; Dipeptidyl peptidase IV 60 kDa soluble form; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase IV soluble form; dipeptidylpeptidase 4; dipeptidyl-peptidase 4; dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2); dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); DPP IV; DPP4; Dpp-4; DPPIV; DPP-IV; GP110 glycoprotein; I79_016618; serine protease; T-cell activation antigen CD26; THAM; Thymocyte-activating molecule; TP103; WC10
• Common Name: DPP4
• Gene Symbol: DPP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining