Invitrogen™ Human DPP10 (aa 459-529) Control Fragment Recombinant Protein

Product Code. 30208608

Brand: Invitrogen™ RP100811

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111281 (PA5-111281. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A novel gene, DPP10, encodes a homolog of dipeptidyl peptidases (DPPs) that cleave terminal dipeptides from cytokines and chemokines, and it presents a potential new target for asthma therapy. The DPP10 protein shares features with members of the S9B family of DPP serine proteases, which includes DPP4, a widely expressed enzyme that plays a central role in chemokine processing as part of the innate immune system. The locus displays a complex pattern of transcript splicing, with eight alternate first axons; four of which localize within the LD block strongly associated with asthma.

Specifications

• Accession Number: Q8N608
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57628
• Name: Human DPP10 (aa 459-529) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430601K09Rik; dipeptidyl peptidase 10; dipeptidyl peptidase IV-related protein 3; dipeptidyl peptidase like 10; dipeptidyl peptidase X; Dipeptidyl peptidase-like protein 2; dipeptidylpeptidase 10; dipeptidyl-peptidase 10 (inactive); dipeptidyl-peptidase 10 (non-functional); DPL2; DPP X; DPP10; DPPY; Dprp3; DPRP-3; HGNC:20823; inactive dipeptidyl peptidase 10; KIAA1492; Kv4 potassium channel auxiliary subunit; OTTHUMP00000203618
• Common Name: DPP10
• Gene Symbol: DPP10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining