Invitrogen™ Human DPM1 (aa 3-85) Control Fragment Recombinant Protein

Product Code. 30180622

Brand: Invitrogen™ RP99290

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62490 (PA5-62490. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2.

Specifications

• Accession Number: O60762
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8813
• Name: Human DPM1 (aa 3-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI118379; AI194292; CDGIE; dolichol monophosphate mannose synthase; dolichol-phosphate (beta-D) mannosyltransferase 1; Dolichol-phosphate mannose synthase; Dolichol-phosphate mannose synthase subunit 1; Dolichol-phosphate mannosyltransferase; Dolichol-phosphate mannosyltransferase subunit 1; dolichyl-phosphate beta-D-mannosyltransferase; Dolichyl-phosphate beta-D-mannosyltransferase subunit 1; dolichyl-phosphate mannosyltransferase 1; dolichyl-phosphate mannosyltransferase polypeptide 1 catalytic subunit; dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit; DPM synthase; DPM synthase complex, catalytic subunit; DPM synthase subunit 1; Dpm1; Mannose-P-dolichol synthase; Mannose-P-dolichol synthase subunit 1; MPD synthase; MPD synthase subunit 1; MPDS; OTTMUSP00000017164; P9705.3; RP23-391M18.1; SED3; YPR183W
• Common Name: DPM1
• Gene Symbol: DPM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining