missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DPF2 (aa 234-272) Control Fragment Recombinant Protein

Product Code. 30206987
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206987

Brand: Invitrogen™ RP105052

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84309 (PA5-84309. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92785
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5977
Name Human DPF2 (aa 234-272) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210010M07Rik; apoptosis response zinc finger protein; BAF45D; BRG1-associated factor 45 D; D4, zinc and double PHD fingers family 2; double PHD fingers 2; Dpf2; neuro-d4/requiem; protein requiem; Req; requiem; requiem, apoptosis response zinc finger; UBID4; ubi-d4; Zinc finger protein ubi-d4
Common Name DPF2
Gene Symbol Dpf2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.