Invitrogen™ Human DPEP3 (aa 410-459) Control Fragment Recombinant Protein

Product Code. 30195951

Brand: Invitrogen™ RP101813

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63597 (PA5-63597. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a membrane-bound glycoprotein from the family of dipeptidases involved in hydrolytic metabolism of various dipeptides, including penem and carbapenem beta-lactam antibiotics. This gene is located on chromosome 16 in a cluster with another member of this family. Alternatively spliced transcript variants that encode different isoforms have been found for this gene.

Specifications

• Accession Number: Q9H4B8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64180
• Name: Human DPEP3 (aa 410-459) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700018F16Rik; AI507039; Dipeptidase 3; DPEP3; Mbd3; MBD-3; Membrane-bound dipeptidase 3; metallopeptidase (family M19); MLZ-136; Protein expressed in male leptotene and zygotene spermatocytes 136; putative membrane-bound dipeptidase 3; testis secretory sperm-binding protein Li 211 A; UNQ834/PRO1772
• Common Name: DPEP3
• Gene Symbol: DPEP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining