Invitrogen™ Human DPCR1 (aa 14-149) Control Fragment Recombinant Protein

Product Code. 30213448

Brand: Invitrogen™ RP90421

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53115 (PA5-53115. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of DPCR1 remains unknown.

Specifications

• Accession Number: Q3MIW9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 135656
• Name: Human DPCR1 (aa 14-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bCX105N19.6; C6orf37; diffuse panbronchiolitis critical region 1; diffuse panbronchiolitis critical region protein 1; DPCR1; MGC126710; MGC126712; Mucin-like protein 3; MUCL3; PBLT
• Common Name: DPCR1
• Gene Symbol: DPCR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining