Invitrogen™ Human DONSON (aa 450-554) Control Fragment Recombinant Protein

Product Code. 30200854

Brand: Invitrogen™ RP103043

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61865 (PA5-61865. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DONSON is essential for DNA amplification in the ovary and required for cell proliferation during development.

Spécification

• Accession Number: Q9NYP3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29980
• Name: Human DONSON (aa 450-554) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B17; C21orf60; C2TA; DONSON; downstream neighbor of SON; protein downstream neighbor of Son
• Common Name: DONSON
• Gene Symbol: DONSON
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining