Invitrogen™ Human DOK6 (aa 232-269) Control Fragment Recombinant Protein

Product Code. 30202382

Brand: Invitrogen™ RP107246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DOK-6 (docking protein 6), is a novel member of the Dok-4/5 subclass of the p62 Dok family of intracellular adaptor molecules. Dok-6 is highly expressed in the developing central nervous system and is co-expressed with Ret in several locations, including sympathetic, sensory, and parasympathetic ganglia, as well as in the ureteric buds of the developing kidneys. Pull-down assays using the Dok-6 phosphotyrosine binding (PTB) domain and GDNF-activated Ret indicate that Dok-6 binds to the phosphorylated Ret Tyr(1062) residue. Moreover, ligand activation of Ret resulted in phosphorylation of tyrosine residue(s) located within the unique C terminus of Dok-6 predominantly through a Src-dependent mechanism, indicating that Dok-6 is a substrate of the Ret-Src signaling pathway. (Crowder RJ, Enomoto H, Yang M, Johnson EM Jr, Milbrandt J. Dok-6, a Novel p62 Dok family member, promotes Ret-mediated neurite outgrowth. J Biol Chem. 2004 Oct 1;279(40):42072-81. Epub 2004 Jul 30. It is also known as DOK6, HsT3226, MGC20785 or IRS. 0.

Specifications

• Accession Number: Q6PKX4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 220164
• Name: Human DOK6 (aa 232-269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Docking protein 6; DOK5L; Dok6; Dok-6; Downstream of tyrosine kinase 6; downstream of tyrosine kinases 6; HsT3226; RGD1564376
• Common Name: DOK6
• Gene Symbol: Dok6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining