Invitrogen™ Human DOK3 (aa 425-486) Control Fragment Recombinant Protein

Product Code. 30211420

Brand: Invitrogen™ RP108292

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85028 (PA5-85028. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DOK3 DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK3 is a negative regulator of JNK signaling in B-cells through interaction with INPP5D/SHIP1. May modulate ABL1 function.

Specifications

• Accession Number: Q7L591
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79930
• Name: Human DOK3 (aa 425-486) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI450713; Docking protein 3; Dok3; Dokl; DOK-L; Dok-like protein; downstream of tyrosine kinase 3; FLJ22570; FLJ39939; p62(dok)-like protein; p62Dok-like protein
• Common Name: DOK3
• Gene Symbol: DOK3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining