Invitrogen™ Human DOG-1 Control Fragment Recombinant Protein

Product Code. 30208720

Brand: Invitrogen™ RP108211

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84336 (PA5-84336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DOG-1, the novel marker, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of kit or PDGFR alpha mutation status.

Specifications

• Accession Number: Q5XXA6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55107
• Name: Human DOG-1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANO1; anoctamin 1; anoctamin 1, calcium activated chloride channel; anoctamin-1; Ca2+-activated Cl- channel; calcium activated chloride channel; discovered on gastrointestinal stromal tumors protein 1; DOG1; FLJ10261; oral cancer overexpressed 2; Oral cancer overexpressed protein 2; ORAOV2; TAOS2; Tmem16a; Transmembrane protein 16 A; transmembrane protein 16 A (eight membrane-spanning domains); tumor-amplified and overexpressed sequence 2
• Common Name: DOG-1
• Gene Symbol: ANO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVEVFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining