Invitrogen™ Human DNHD1 (aa 4080-4163) Control Fragment Recombinant Protein

Product Code. 30194629

Brand: Invitrogen™ RP97335

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58888 (PA5-58888. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNHD1 is a protein coding gene. Gene ontology (GO) annotation include dynein complex; extracellular exosome.

Specifications

• Accession Number: Q96M86
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 144132
• Name: Human DNHD1 (aa 4080-4163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8030491N06Rik; C11orf47; CCDC35; coiled-coil domain containing 35; DHCD1; DKFZp686J0796; DNHD1; DNHD1 variant protein; DNHD1L; dynein heavy chain domain 1; dynein heavy chain domain 1-like protein; Dynein heavy chain domain-containing protein 1; FLJ32752; FLJ35709; FLJ46184; Protein CCDC35; UNQ5781/PRO12970
• Common Name: DNHD1
• Gene Symbol: DNHD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining