Invitrogen™ Human DNAL4 (aa 1-105) Control Fragment Recombinant Protein

Product Code. 30211048

Brand: Invitrogen™ RP91542

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51983 (PA5-51983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity.

Specifications

• Accession Number: O96015
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10126
• Name: Human DNAL4 (aa 1-105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D15Ertd424e; DNAL4; Dnalc4; dynein axonemal light chain 4; dynein light chain 4, axonemal; dynein light chain, outer arm 4; dynein, axon, light chain 4; dynein, axonemal, light chain 4; dynein, axonemal, light polypeptide 4; MRMV3; outer arm dynein light chain 4; PIG27; proliferation-inducing gene 27; proliferation-inducing protein 27
• Common Name: DNAL4
• Gene Symbol: DNAL4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining