Invitrogen™ Human DNAJC5G (aa 79-115) Control Fragment Recombinant Protein

Product Code. 30199109

Brand: Invitrogen™ RP102907

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59575 (PA5-59575. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8N7S2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285126
• Name: Human DNAJC5G (aa 79-115) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4922503E23Rik; CSP-gamma; Cysteine string protein-gamma; DNAJ; DnaJ (Hsp40) homolog, subfamily C, member 5 gamma; DnaJ heat shock protein family (Hsp40) member C5 gamma; dnaJ homolog subfamily C member 5 G; Dnajc5g; FLJ40417; gamma cysteine string protein; gamma-CSP; gamma-cysteine string protein
• Common Name: DNAJC5G
• Gene Symbol: DNAJC5G
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining