missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208903

Invitrogen™ Human DNAJC24 (aa 80-148) Control Fragment Recombinant Protein

Product Code. 30208903
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208903

Brand: Invitrogen™ RP92431

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55232 (PA5-55232. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron- bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6P3W2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 120526
Name Human DNAJC24 (aa 80-148) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700030A21Rik; 2610027M02Rik; AV066965; AW240712; CSL-type zinc finger-containing protein 3; diphthamide biosynthesis protein 4; DnaJ (Hsp40) homolog, subfamily C, member 24; DnaJ heat shock protein family (Hsp40) member C24; dnaJ homolog subfamily C member 24; Dnajc24; DPH4; DPH4 homolog (JJJ3, S. cerevisiae); DPH4, JJJ3 homolog; j domain protein DjC7; JJJ3; MmDjC7; ZCSL3; zinc finger, CSL domain containing 3; zinc finger, CSL-type containing 3
Common Name DNAJC24
Gene Symbol DNAJC24
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.