missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195939

Invitrogen™ Human DNAJC21 (aa 330-418) Control Fragment Recombinant Protein

Product Code. 30195939
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195939 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195939 Supplier Invitrogen™ Supplier No. RP106222

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65550 (PA5-65550. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a co-chaperone for HSP70. May play a role in ribosomal RNA (rRNA) biogenesis, possibly in the maturation of the 60S subunit. Binds the precursor 45S rRNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5F1R6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 134218
Name Human DNAJC21 (aa 330-418) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930461P20Rik; 9930116P15Rik; DnaJ (Hsp40) homolog, subfamily C, member 21; DnaJ heat shock protein family (Hsp40) member C21; dnaJ homolog subfamily A member 5; DnaJ homolog subfamily C member 21; DnaJ homology subfamily A member 5; dnaja5; dnajc21; fa66c02; GS3; JJJ1; JJJ1 DnaJ domain protein homolog; Protein GS3; putative regulation protein GS3; Unknown (protein for MGC:63563); wu:fa66c02; zgc:63563
Common Name DNAJC21
Gene Symbol DNAJC21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KNHEKSKKHREMVALLKQQLEEEEENFSRPQIDENPLDDNSEEEMEDAPKQKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.