Invitrogen™ Human DNAJC21 (aa 330-418) Control Fragment Recombinant Protein

Artikelnummer. 30195939

Marke: Invitrogen™ RP106222

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65550 (PA5-65550. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a co-chaperone for HSP70. May play a role in ribosomal RNA (rRNA) biogenesis, possibly in the maturation of the 60S subunit. Binds the precursor 45S rRNA.

Spezifikation

• Accession Number: Q5F1R6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 134218
• Name: Human DNAJC21 (aa 330-418) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930461P20Rik; 9930116P15Rik; DnaJ (Hsp40) homolog, subfamily C, member 21; DnaJ heat shock protein family (Hsp40) member C21; dnaJ homolog subfamily A member 5; DnaJ homolog subfamily C member 21; DnaJ homology subfamily A member 5; dnaja5; dnajc21; fa66c02; GS3; JJJ1; JJJ1 DnaJ domain protein homolog; Protein GS3; putative regulation protein GS3; Unknown (protein for MGC:63563); wu:fa66c02; zgc:63563
• Common Name: DNAJC21
• Gene Symbol: DNAJC21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KNHEKSKKHREMVALLKQQLEEEEENFSRPQIDENPLDDNSEEEMEDAPKQKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining