missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210855

Invitrogen™ Human DNAJC19 (aa 23-57) Control Fragment Recombinant Protein

Product Code. 30210855
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210855

Brand: Invitrogen™ RP96482

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58102 (PA5-58102. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96DA6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 131118
Name Human DNAJC19 (aa 23-57) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810055D05Rik; AA959924; DnaJ (Hsp40) homolog, subfamily C, member 19; DnaJ heat shock protein family (Hsp40) member C19; dnaJ homolog subfamily C member 19; DnaJ homolog, subfamily C, member 19; DNAJC19; DnaJ-like protein subfamily C member 19; homolog of yeast TIM14; hypothetical protein LOC513918; hypothetical protein MGC73251; mitochondrial import inner membrane translocase subunit TIM14; PAM18; RGD1560220; TIM14; TIMM14; zgc:73251
Common Name DNAJC19
Gene Symbol Dnajc19
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.