Invitrogen™ Human DNAJC13 (aa 132-223) Control Fragment Recombinant Protein

Product Code. 30201032

Brand: Invitrogen™ RP96342

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57872 (PA5-57872. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAJC13, also known as receptor-mediated endocytosis 8 (RME8), is the human homolog to a DnaJ domain-containing protein originally identified in a screen for endocytic defects in C. elegans. It is thought to be a co-chaperone of Hsc70 which regulates protein conformation at membrane sites and plays a role in intracellular trafficking, co-localizing with markers of the endosomal system. Recent experiments have indicated that the DNAJC13 protein is involved in membrane trafficking through early endosomes but not through degradative organelles. DNAJC13 has been also been shown to regulate the intracellular trafficking of the epidermal growth factor receptor.

Specifications

• Accession Number: O75165
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23317
• Name: Human DNAJC13 (aa 132-223) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D030002L11Rik; DnaJ (Hsp40) homolog, subfamily C, member 13; DnaJ domain-containing protein RME-8; DnaJ heat shock protein family (Hsp40) member C13; dnaJ homolog subfamily C member 13; DNAJC13; Gm1124; j-domain containing protein, required for endocytosis; KIAA0678; mKIAA0678; PARK21; receptor mediated endocytosis RME-8; required for receptor-mediated endocytosis 8; Rme8; RME-8
• Common Name: DNAJC13
• Gene Symbol: DNAJC13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining