missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195399

Invitrogen™ Human DNAJC10 (aa 331-475) Control Fragment Recombinant Protein

Product Code. 30195399
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195399 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195399 Supplier Invitrogen™ Supplier No. RP89989

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56645 (PA5-56645. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IXB1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54431
Name Human DNAJC10 (aa 331-475) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200006L06Rik; D2Ertd706e; DnaJ (Hsp40) homolog, subfamily C, member 10; DnaJ heat shock protein family (Hsp40) member C10; dnaJ homolog subfamily C member 10; DNAJC10; DnaJ-like protein subfamily C member 10-like protein; Endoplasmic reticulum DNA J domain-containing protein 5; endoplasmic reticulum DnaJ-PDI fusion protein 1; ERdj5; ER-resident protein ERdj5; J domain-containing PDI-like protein; j domain-containing protein disulfide isomerase-like protein; J-domain-containing protein disulfide isomerase-like protein; Jpdi; Macrothioredoxin; MTHr; PDIA19; protein disulfide isomerase family A, member 19; UNQ495/PRO1012; zgc:162218
Common Name DNAJC10
Gene Symbol Dnajc10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LNSLDAKEIYLEVIHNLPDFELLSANTLEDRLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.