Invitrogen™ Human DNAJC10 (aa 331-475) Control Fragment Recombinant Protein

Código de producto. 30195399

Marca: Invitrogen™ RP89989

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56645 (PA5-56645. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.

Especificaciones

• Accession Number: Q8IXB1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54431
• Name: Human DNAJC10 (aa 331-475) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200006L06Rik; D2Ertd706e; DnaJ (Hsp40) homolog, subfamily C, member 10; DnaJ heat shock protein family (Hsp40) member C10; dnaJ homolog subfamily C member 10; DNAJC10; DnaJ-like protein subfamily C member 10-like protein; Endoplasmic reticulum DNA J domain-containing protein 5; endoplasmic reticulum DnaJ-PDI fusion protein 1; ERdj5; ER-resident protein ERdj5; J domain-containing PDI-like protein; j domain-containing protein disulfide isomerase-like protein; J-domain-containing protein disulfide isomerase-like protein; Jpdi; Macrothioredoxin; MTHr; PDIA19; protein disulfide isomerase family A, member 19; UNQ495/PRO1012; zgc:162218
• Common Name: DNAJC10
• Gene Symbol: Dnajc10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNSLDAKEIYLEVIHNLPDFELLSANTLEDRLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining