Invitrogen™ Human DNAJB7 (aa 7-145) Control Fragment Recombinant Protein

Product Code. 30212023

Brand: Invitrogen™ RP91387

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51405 (PA5-51405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAJB7 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 ).

Specifications

• Accession Number: Q7Z6W7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 150353
• Name: Human DNAJB7 (aa 7-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933424H20Rik; DJ5; DnaJ (Hsp40) homolog, subfamily B, member 7; DnaJ heat shock protein family (Hsp40) member B7; dnaJ homolog subfamily B member 7; Dnajb7; dnaJ-like 5; HSC3; mDj5; novel DnaJ domain protein
• Common Name: DNAJB7
• Gene Symbol: Dnajb7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining