Invitrogen™ Human DNAJB5 (aa 283-348) Control Fragment Recombinant Protein

Product Code. 30208967

Brand: Invitrogen™ RP106314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84031 (PA5-84031. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAJB5 belongs to the evolutionarily conserved DNAJ/HSP40 protein family. For background information on the DNAJ family.

Specifications

• Accession Number: O75953
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25822
• Name: Human DNAJB5 (aa 283-348) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110058L06Rik; AI462558; DnaJ (Hsp40) homolog, subfamily B, member 5; DnaJ heat shock protein family (Hsp40) member B5; dnaJ homolog subfamily B member 5; DNAJB5; heat shock cognate 40; heat shock protein cognate 40; Heat shock protein Hsp40-2; heat shock protein hsp40-3; Hsc40; Hsp40-3
• Common Name: DNAJB5
• Gene Symbol: DNAJB5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining