missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DNAJB4 (aa 274-337) Control Fragment Recombinant Protein

Product Code. 30196355
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196355

Brand: Invitrogen™ RP94389

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55833 (PA5-55833. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DnaJ heat shock induced proteins are from the bacterium Escherichia coli and are under the control of the htpR regulatory protein. The DnaJ proteins play a critical role in the HSP 70 chaperone machine by interacting with HSP 70 to stimulate ATP hydrolysis. The proteins contain cysteine rich regions that are composed of zinc fingers that form a peptide binding domain responsible for the chaperone function. DnaJ proteins are important mediators of proteolysis and are involved in the regulation of protein degradation, exocytosis and endocytosis. DnaJB4 (DnaJ homolog subfamily B member 4), also known as HLJ1, is expressed in skeletal muscle, heart and pancreas, and lower expression in brain, placenta and liver.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UDY4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11080
Name Human DNAJB4 (aa 274-337) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700029A20Rik; 2010306G19Rik; 5730460G06Rik; DjB4; DnaJ (Hsp40) homolog, subfamily B, member 4; DnaJ (Hsp40) homolog, subfamily B, member 4-like; DnaJ heat shock protein family (Hsp40) member B4; dnaJ homolog subfamily B member 4; DNAJB 4; Dnajb4; DnaJ-like heat shock protein 40; DNAJW; Heat shock 40 kDa protein 1 homolog; heat shock protein 40 homolog; HLJ 1; HLJ1; HSP40 homolog; human liver DnaJ-like protein
Common Name DNAJB4
Gene Symbol Dnajb4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.