Invitrogen™ Human DNAJB12 (aa 270-330) Control Fragment Recombinant Protein

Product Code. 30202601

Brand: Invitrogen™ RP109303

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000).

Specifications

• Accession Number: Q9NXW2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54788
• Name: Human DNAJB12 (aa 270-330) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DJ10; DKFZp586B2023; DnaJ (Hsp40) homolog, subfamily B, member 12; DnaJ heat shock protein family (Hsp40) member B12; DnaJ homolog 10; dnaJ homolog subfamily B member 12; DnaJ subfamily B member 12-like protein; Dnajb12; LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 12; mDj10
• Common Name: DNAJB12
• Gene Symbol: DNAJB12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining