Invitrogen™ Human DNAI1 (aa 246-340) Control Fragment Recombinant Protein

Product Code. 30194217

Brand: Invitrogen™ RP92940

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54526 (PA5-54526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotic cells rely on actin and microtubule-based protein 'motors' to generate intracellular movements. These protein 'motors' contain specialized domains that hydrolyze ATP to produce force and movement along a cytoskeletal polymer (actin in the case of myosin family and microtubules in the case of the kinesin family and dyneins). Dynein has been implicated in cytoplasmic motile functions, including chromosomal movement, retrograde organelle and axonal transport, the endocytic pathway, and the organization of the Golgi apparatus. In all cell types, dynein has the same basic structures and is composed of two or three distinct heavy chains (∽450 kDa), three intermediate chains (70-125 kDa), and at least four light chains (15-25 kDa).

Specifications

• Accession Number: Q9UI46
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27019
• Name: Human DNAI1 (aa 246-340) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110066F04Rik; axonemal dynein intermediate chain 1; b2b1526Clo; BB124644; CILD1; DIC1; Dnai1; Dnaic1; dynein axonemal intermediate chain 1; Dynein intermediate chain 1, axonemal; dynein, axonemal, intermediate chain 1; dynein, axonemal, intermediate polypeptide 1; I79_025143; ICS; ICS1; immotile cilia syndrome 1; MGC26204; PCD; RP11-296L22.2; testis tissue sperm-binding protein Li 87 P
• Common Name: DNAI1
• Gene Symbol: DNAI1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining