Invitrogen™ Human DNAH6 (aa 1983-2064) Control Fragment Recombinant Protein

Product Code. 30194766

Brand: Invitrogen™ RP96019

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57636 (PA5-57636. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAH6 is a protein coding gene.

Specifications

• Accession Number: Q9C0G6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1768
• Name: Human DNAH6 (aa 1983-2064) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830168K20; A730004I20Rik; axo a; Axonemal beta dynein heavy chain 6; axonemal dynein heavy chain; ciliary dynein heavy chain 6; DNAH6; Dnahc6; DNHL1; dynein axonemal heavy chain 6; dynein heavy chain 6, axonemal; dynein heavy chain-like 1; dynein, axon, heavy chain 6; dynein, axonemal, heavy chain 6; dynein, axonemal, heavy polypeptide 6; HL2; HL-2; KIAA1697; mdhc6; mKIAA1697
• Common Name: DNAH6
• Gene Symbol: DNAH6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining