Invitrogen™ Human DNAH5 (aa 54-142) Control Fragment Recombinant Protein

Product Code. 30208182

Brand: Invitrogen™ RP96796

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57958 (PA5-57958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a dynein protein, which is part of a microtubule-associated motor protein complex consisting of heavy, light, and intermediate chains. This protein is an axonemal heavy chain dynein. It functions as a force-generating protein with ATPase activity, whereby the release of ADP is thought to produce the force-producing power stroke. Mutations in this gene cause primary ciliary dyskinesia type 3, as well as Kartagener syndrome, which are both diseases due to ciliary defects.

Specifications

• Accession Number: Q8TE73
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1767
• Name: Human DNAH5 (aa 54-142) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU022615; Axonemal beta dynein heavy chain 5; axonemal dynein heavy chain 5; b2b1134Clo; b2b1154Clo; b2b1537Clo; b2b1565Clo; b2b601Clo; CILD3; Ciliary dynein heavy chain 5; DLP5; Dnah5; Dnahc5; Dnahc8; dynein axonemal heavy chain 5; dynein heavy chain 5, axonemal; dynein, axon, heavy chain 5; dynein, axonemal, heavy chain 5; dynein, axonemal, heavy polypeptide 5; dynein-like protein 5; HL1; KIAA1603; KTGNR; Mdnah5; mKIAA1603; PCD
• Common Name: DNAH5
• Gene Symbol: DNAH5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining