missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DNAH17 (aa 858-955) Control Fragment Recombinant Protein

Product Code. 30198437
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198437

Brand: Invitrogen™ RP108279

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84995 (PA5-84995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains. DNAH17 is a heavy chain associated with axonemal dynein (Milisav and Affara, 1998 [PubMed 9545504]).[supplied by OMIM, Mar 2008].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UFH2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8632
Name Human DNAH17 (aa 858-955) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Axonemal beta dynein heavy chain 17; axonemal dynein heavy chain; axonemal dynein heavy chain-like protein 1; Ciliary dynein heavy chain 17; ciliary dynein heavy chain-like protein 1; DNAH17; DNAHL1; DNEL2; dynein axonemal heavy chain 17; dynein heavy chain 17, axonemal; Dynein light chain 2, axonemal; dynein, axonemal, heavy chain 17; dynein, axonemal, heavy chain like 1; dynein, axonemal, heavy like 1; dynein, axonemal, heavy polypeptide 17; FLJ40457
Common Name DNAH17
Gene Symbol DNAH17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.