Invitrogen™ Human DNAH17 (aa 466-552) Control Fragment Recombinant Protein

Product Code. 30207630

Brand: Invitrogen™ RP93459

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains. DNAH17 is a heavy chain associated with axonemal dynein (Milisav and Affara, 1998 [PubMed 9545504]).[supplied by OMIM, Mar 2008].

Specifications

• Accession Number: Q9UFH2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8632
• Name: Human DNAH17 (aa 466-552) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Axonemal beta dynein heavy chain 17; axonemal dynein heavy chain; axonemal dynein heavy chain-like protein 1; Ciliary dynein heavy chain 17; ciliary dynein heavy chain-like protein 1; DNAH17; DNAHL1; DNEL2; dynein axonemal heavy chain 17; dynein heavy chain 17, axonemal; Dynein light chain 2, axonemal; dynein, axonemal, heavy chain 17; dynein, axonemal, heavy chain like 1; dynein, axonemal, heavy like 1; dynein, axonemal, heavy polypeptide 17; FLJ40457
• Common Name: DNAH17
• Gene Symbol: DNAH17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAVRKHPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining